PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA27G00043
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 243aa    MW: 28425.1 Da    PI: 7.1305
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA27G00043genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.35.7e-161662148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +grW+  Ed+ l ++v+ +G++ Wk++a+++  gRt+kqc++rw+++l
       AA27G00043 16 KGRWSCNEDKWLRNLVENYGKNEWKKVAKMFK-GRTGKQCRERWLNHL 62
                     79*****************************9.*************97 PP

2Myb_DNA-binding55.11.7e-1770110345
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       WT+eE+ +lv+a+k+ G++ W+ Ia++++ gR+++ +k++w+
       AA27G00043  70 IWTEEEERILVEAHKEIGNK-WTVIAKRLP-GRSDNTVKNHWN 110
                      6*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.1811162IPR017930Myb domain
SuperFamilySSF466895.24E-3013109IPR009057Homeodomain-like
SMARTSM007172.6E-131564IPR001005SANT/Myb domain
PfamPF002491.5E-141662IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.0E-241769IPR009057Homeodomain-like
CDDcd001678.23E-121862No hitNo description
PROSITE profilePS5129423.88663117IPR017930Myb domain
SMARTSM007171.2E-1567115IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.5E-2170115IPR009057Homeodomain-like
PfamPF002491.5E-1571110IPR001005SANT/Myb domain
CDDcd001674.07E-1171113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MLHITNKPSE KSRTIKGRWS CNEDKWLRNL VENYGKNEWK KVAKMFKGRT GKQCRERWLN  60
HLRPHIKKDI WTEEEERILV EAHKEIGNKW TVIAKRLPGR SDNTVKNHWN ATKRRVLSRK  120
TKGQDLSCTN ILINYMISIT EDSNSIVTDL TVQKFNNYNN DDDELKYYIN ELLMSPSLEA  180
EISTFPPIPT DSVWEDIIKS FDGDEFKDID DFFMDTSLEA EMHAMTPLTS GFTTSTYPPT  240
TTN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-37151153103MYB PROTO-ONCOGENE PROTEIN
1mse_C1e-37151153103C-Myb DNA-Binding Domain
1msf_C1e-37151153103C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006292464.17e-53hypothetical protein CARUB_v10018693mg
SwissprotQ9S7L26e-47MYB98_ARATH; Transcription factor MYB98
TrEMBLA0A078DBR63e-54A0A078DBR6_BRANA; BnaA06g31890D protein
STRINGfgenesh2_kg.5__560__AT3G27785.13e-52(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM60522643
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27785.15e-54myb domain protein 118